Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

FGFBP3 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-82783

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-82783-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for FGFBP3 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGFBP3. Peptide sequence: GTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FGFBP3 Antibody

Western Blot: FGFBP3 Antibody [NBP2-82783] - Host: Rabbit. Target Name: FGFBP3. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for FGFBP3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGFBP3

Long Name

Fibroblast Growth Factor Binding Protein 3

Alternate Names

C10orf13, FGF-Binding Protein 3, FGF-BP3, FGFBP-3

Gene Symbol

FGFBP3

Additional FGFBP3 Products

Product Documents for FGFBP3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FGFBP3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Loading...