Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

FGFBP3 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-30824

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-30824
NBP2-30824-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for FGFBP3 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FGFBP3 Antibody

Immunohistochemistry: Fibroblast Growth Factor Binding Protein 3 Antibody [NBP2-30824] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.

Applications for FGFBP3 Antibody

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGFBP3

Long Name

Fibroblast Growth Factor Binding Protein 3

Alternate Names

C10orf13, FGF-Binding Protein 3, FGF-BP3, FGFBP-3

Gene Symbol

FGFBP3

UniProt

Additional FGFBP3 Products

Product Documents for FGFBP3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FGFBP3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...