FGD1 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83906
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (92%). Backed by our 100% Guarantee.
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSDPGASEPGLLARRGSGSALGGPLDPQFVGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPEGPQRLRSDP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit FGD1 Antibody - BSA Free (NBP1-83906) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for FGD1 Antibody - BSA Free
Western Blot: FGD1 Antibody - BSA Free [NBP1-83906]
Analysis in human cell line U-2197.Applications for FGD1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
0.04-0.4 ug/ml
Formulation, Preparation, and Storage
Purification
Immunogen affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FGD1
Alternate Names
faciogenital dysplasia (Aarskog-ScRhoGEF and PH domain-containing protein 1, Faciogenital dysplasia 1 protein, FGDYMRXS16, FYVE, RhoGEF and PH domain containing 1, Rho/Rac guanine nucleotide exchange factor FGD1, ZFYVE3AAS, Zinc finger FYVE domain-containing protein 3
Gene Symbol
FGD1
Additional FGD1 Products
Product Documents for FGD1 Antibody - BSA Free
Product Specific Notices for FGD1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...