Cytokeratin 7 Antibody (5V4M10)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16388
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5V4M10 expressed in HEK293
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 291-463 of human Cytokeratin 7 (KRT7) (P08729). QAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASAS
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit Cytokeratin 7 Antibody (5V4M10) (NBP3-16388) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Cytokeratin 7 Antibody (5V4M10)
Western Blot: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] -
Western Blot: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Western blot analysis of various lysates using Cytokeratin 7 Rabbit mAb at 1:20000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Negative control (NC): MCF-7
Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] -
Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunofluorescence analysis of paraffin-embedded Human lung tissue using Cytokeratin 7 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] -
Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using Cytokeratin 7 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.Applications for Cytokeratin 7 Antibody (5V4M10)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Cytokeratin 7
Alternate Names
CK-7, CK7, K2C7, K7
Gene Symbol
KRT7
Additional Cytokeratin 7 Products
Product Documents for Cytokeratin 7 Antibody (5V4M10)
Product Specific Notices for Cytokeratin 7 Antibody (5V4M10)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...