Complement C3 Antibody (X1) - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # H00000718-M11-100ug
Key Product Details
Species Reactivity
Human
Applications
ELISA, Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # X1
Format
Azide and BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This Complement C3 Antibody (X1) was developed against C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Theoretical MW
187 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Complement C3 Antibody (X1) - Azide and BSA Free
Western Blot: Complement C3 Antibody (X1) [H00000718-M11-100ug]
Western Blot: Complement C3 Antibody (X1) [H00000718-M11-100ug] - Detection against Immunogen (37.95 kDa).Applications for Complement C3 Antibody (X1) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Formulation, Preparation, and Storage
Purification
Protein A or G purified
Formulation
PBS (pH 7.4)
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Complement C3
Both elevated levels and reduced levels of Complement C3 has been implicated in diseases pathologies (6). Deficiency in Complement proteins can result in autoimmune disorders including systemic lupus erythematosus, which is more often associated with C1 or C4 deficiency and only rarely with C3 deficiency (6). However, C3 deficiency typically results in increased risk of recurrent bacterial infections and glomerulonephritis, characterized by inflammation of the filtering glomeruli in the kidneys (6). Additionally, elevated levels of C3a and C4a is seen in patients with antiphospholipid antibody syndrome (6). Serum levels of C3 are also higher in rheumatoid arthritis cases (6). The complement system has become a target for drugs and therapeutics aimed at modulating innate immunity (7). For instance, compstatin is a peptide that binds to C3, inhibiting convertase activity and cleavage and can be used to treat diseases associated with uncontrolled C3 activation (7). C3-inhibitors and other complement inhibitors are a promising drug candidate for treatment of many diseases (7).
References
1. Mathern, D. R., & Heeger, P. S. (2015). Molecules Great and Small: The Complement System. Clinical Journal of the American Society of Nephrology: CJASN. https://doi.org/10.2215/CJN.06230614
2. Merle, N. S., Church, S. E., Fremeaux-Bacchi, V., & Roumenina, L. T. (2015). Complement System Part I - Molecular Mechanisms of Activation and Regulation. Frontiers in Immunology. https://doi.org/10.3389/fimmu.2015.00262
3. Ricklin, D., Reis, E. S., Mastellos, D. C., Gros, P., & Lambris, J. D. (2016). Complement component C3 - The "Swiss Army Knife" of innate immunity and host defense. Immunological Reviews. https://doi.org/10.1111/imr.12500
4. Merle, N. S., Noe, R., Halbwachs-Mecarelli, L., Fremeaux-Bacchi, V., & Roumenina, L. T. (2015). Complement System Part II: Role in Immunity. Frontiers in Immunology. https://doi.org/10.3389/fimmu.2015.00257
5. Sahu, A., & Lambris, J. D. (2001). Structure and biology of complement protein C3, a connecting link between innate and acquired immunity. Immunological Reviews. https://doi.org/10.1034/j.1600-065x.2001.1800103.x
6. Vignesh, P., Rawat, A., Sharma, M., & Singh, S. (2017). Complement in autoimmune diseases. Clinica Chimica Acta; International Journal of Clinical Chemistry. https://doi.org/10.1016/j.cca.2016.12.017
7. Mastellos, D. C., Yancopoulou, D., Kokkinos, P., Huber-Lang, M., Hajishengallis, G., Biglarnia, A. R., Lupu, F., Nilsson, B., Risitano, A. M., Ricklin, D., & Lambris, J. D. (2015). Compstatin: a C3-targeted complement inhibitor reaching its prime for bedside intervention. European Journal of Clinical Investigation. https://doi.org/10.1111/eci.12419
Alternate Names
Acylation Stimulating Protein, acylation-stimulating protein cleavage product, AHUS5, ARMD9, ASP, C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3a, C3a anaphylatoxin, C3adesArg, C3b, C3bc, C3-beta-c, complement C3, Complement C3 alpha chain, Complement C3 beta chain, Complement C3b alpha' chain, Complement C3c alpha' chain fragment 1, Complement C3c alpha' chain fragment 2, Complement C3d fragment, Complement C3dg fragment, Complement C3f fragment, Complement C3g fragment, complement component 3, complement component C3, complement component C3a, complement component C3b, CPAMD1, EC 3.4.21.43, epididymis secretory sperm binding protein Li 62p, HEL-S-62p, prepro-C3
Entrez Gene IDs
718 (Human)
Gene Symbol
C3
OMIM
120700 (Human)
UniProt
Additional Complement C3 Products
Product Documents for Complement C3 Antibody (X1) - Azide and BSA Free
Product Specific Notices for Complement C3 Antibody (X1) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
Loading...