Collagen IV Antibody (3V3N3)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-33471
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Concentration
Product Specifications
Immunogen
Sequence:
AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
Clonality
Host
Isotype
Theoretical MW
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Collagen IV Antibody (3V3N3)
Western Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] -
Western Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] - Western blot analysis of lysates from HeLa cells, using Collagen IV Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
Dot Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] -
Dot Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] - Dot-blot analysis of all sorts of peptides using Collagen IV Rabbit mAb antibody at 1:1000 dilution.Collagen IV Antibody (3V3N3) [NBP3-33471] -
Analysis of various lysates using Collagen IV Rabbit mAb at 1:7000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 45 s.Applications for Collagen IV Antibody (3V3N3)
Dot Blot
ELISA
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Preservative
Concentration
Shipping
Stability & Storage
Background: Collagen IV
Collagens comprise a large family of insoluble extracellular glycoproteins that are essential components of connective tissues such as tendons, ligaments, cartilage, bone and skin. The mature polypeptides are secreted as coiled, left-handed helices that subsequently assemble into rope-like collagen fibers. Collagen I is a fibril-forming collagen that requires N- and C- terminal processing. Collagen IV is a network forming collagen whose C-terminus forms dimers and N-terminus forms tetramers.
Alternate Names
Gene Symbol
Additional Collagen IV Products
Product Documents for Collagen IV Antibody (3V3N3)
Product Specific Notices for Collagen IV Antibody (3V3N3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.