Skip to main content

cGAS Antibody - BSA Free

Catalog # NBP3-16666 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16666-100ul
NBP3-16666-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for cGAS Antibody - BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 350-522 of human cGAS (NP_612450.2). KQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for cGAS Antibody - BSA Free

Western Blot: cGAS Antibody [NBP3-16666] - Analysis of extracts of various cell lines, using cGAS antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10043 dilution.Lysates/proteins: 68ug per lane. Blocking buffer: 46% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 60s.
Immunocytochemistry/Immunofluorescence: cGAS Antibody [NBP3-16666] - Analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for cGAS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 50% glycerol, pH7.3

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: cGAS

Alternate Names

C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1

Gene Symbol

CGAS

Product Documents for cGAS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for cGAS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...