CEBP Beta Antibody [mFluor Violet 610 SE]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35083MFV610

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

mFluor Violet 610 SE (Excitation = 421 nm, Emission = 613 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all CEBP Beta Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human CEBP Beta (NP_005185.2).

Sequence:
AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for CEBP Beta Antibody [mFluor Violet 610 SE]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: CEBP Beta

CCAAT/enhancer-binding proteins (C/EBP) consist of a family of transcription factors that play an important role in regulating the balance between cell growth and differentiation. The various isoforms of C/EBP (alpha, beta, gamma, delta, epsilon, zeta) exhibit similar DNA-binding specificities and contain a leucine zipper dimerization domain (1). A number of serine targets of PKA have been identified in C/EBP, suggesting its activities are post-translationally regulated by cAMP (2). Even though, it has been show that C/EBP beta occurs predominantly as a heterodimer (3). C/EBP beta gamma readily heterodimerize with each other as well as with C/EBP alpha (4). Additionally, 3 isoforms of C/EBP beta can be detected (LAP, LAP,LIP)

Alternate Names

C/EBP beta, C/EBP-beta, CCAAT/enhancer binding protein (C/EBP), beta, CCAAT/enhancer-binding protein beta, CRP2, IL6DBP, interleukin 6-dependent DNA-binding protein, LAPTCF-5, Liver activator protein, liver-enriched transcriptional activator protein, MGC32080, NF-IL6, Nuclear factor NF-IL6, nuclear factor of interleukin 6, TCF5NFIL6, Transcription factor 5

Gene Symbol

CEBPB

Additional CEBP Beta Products

Product Documents for CEBP Beta Antibody [mFluor Violet 610 SE]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CEBP Beta Antibody [mFluor Violet 610 SE]

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.