Skip to main content

CEBP Beta Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35083

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human CEBP Beta (NP_005185.2).

Sequence:
AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CEBP Beta Antibody - BSA Free

CEBP Beta Antibody

Western Blot: CEBP Beta Antibody [NBP3-35083] -

Western Blot: CEBP Beta Antibody [NBP3-35083] - Western blot analysis of various lysates, using CEBP Beta Rabbit pAb at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
CEBP Beta Antibody

Immunohistochemistry: CEBP Beta Antibody [NBP3-35083] -

Immunohistochemistry: CEBP Beta Antibody [NBP3-35083] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using CEBP Beta Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
CEBP Beta Antibody

Immunohistochemistry: CEBP Beta Antibody [NBP3-35083] -

Immunohistochemistry: CEBP Beta Antibody [NBP3-35083] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using CEBP Beta Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for CEBP Beta Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CEBP Beta

CCAAT/enhancer-binding proteins (C/EBP) consist of a family of transcription factors that play an important role in regulating the balance between cell growth and differentiation. The various isoforms of C/EBP (alpha, beta, gamma, delta, epsilon, zeta) exhibit similar DNA-binding specificities and contain a leucine zipper dimerization domain (1). A number of serine targets of PKA have been identified in C/EBP, suggesting its activities are post-translationally regulated by cAMP (2). Even though, it has been show that C/EBP beta occurs predominantly as a heterodimer (3). C/EBP beta gamma readily heterodimerize with each other as well as with C/EBP alpha (4). Additionally, 3 isoforms of C/EBP beta can be detected (LAP, LAP,LIP)

Alternate Names

C/EBP beta, C/EBP-beta, CCAAT/enhancer binding protein (C/EBP), beta, CCAAT/enhancer-binding protein beta, CRP2, IL6DBP, interleukin 6-dependent DNA-binding protein, LAPTCF-5, Liver activator protein, liver-enriched transcriptional activator protein, MGC32080, NF-IL6, Nuclear factor NF-IL6, nuclear factor of interleukin 6, TCF5NFIL6, Transcription factor 5

Gene Symbol

CEBPB

Additional CEBP Beta Products

Product Documents for CEBP Beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CEBP Beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...