Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

CD83 Antibody (3G10-1F4), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00009308-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00009308-M01

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunoprecipitation, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3G10-1F4

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for CD83 Antibody (3G10-1F4)

Immunogen

CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

Reactivity Notes

Human. Other species not tested.

Specificity

CD83 - CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for CD83 Antibody (3G10-1F4)

Western Blot: CD83 Antibody (3G10-1F4) [H00009308-M01] - CD83 monoclonal antibody (M01), clone 3G10-1F4. Analysis of CD83 expression in human colon.
Western Blot: CD83 Antibody (3G10-1F4) [H00009308-M01] - Analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody (M01), clone 3G10-1F4.Lane 1: CD83 transfected lysate (Predicted MW: 23 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: CD83 Antibody (3G10-1F4) [H00009308-M01] - Analysis of CD83 transfected lysate using anti-CD83 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD83 MaxPab rabbit polyclonal antibody.

Applications for CD83 Antibody (3G10-1F4)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CD83

CD83 is a 43 kD single chain type I glycoprotein also known as HB15. A member of the immunoglobulin superfamily, CD83 is expressed on a subset of dendritic cells, Langerhans cells, and weakly on activated lymphocytes. Although CD83 is thought to play a role in antigen presentation and/or lymphocyte activation, the precise function of this protein is unknown. CD83 is considered to be a useful marker for mature dendritic cells.

Alternate Names

BL11, CD83, HB15

Entrez Gene IDs

9308 (Human)

Gene Symbol

CD83

OMIM

604534 (Human)

Additional CD83 Products

Product Documents for CD83 Antibody (3G10-1F4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CD83 Antibody (3G10-1F4)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...