Skip to main content

Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-81668

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-81668
NBP1-81668-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Carbonic Anhydrase XII/CA12 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22016510)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carbonic Anhydrase XII/CA12 Antibody

Immunocytochemistry/Immunofluorescence: Carbonic Anhydrase XII/CA12 Antibody [NBP1-81668] - Staining of human cell line RT4 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Carbonic Anhydrase XII/CA12 Antibody [NBP1-81668] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Applications for Carbonic Anhydrase XII/CA12 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

- Reported in (PMID: 26911677).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 5 publications using NBP1-81668 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase XII/CA12

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene.

Alternate Names

CA12

Gene Symbol

CA12

Additional Carbonic Anhydrase XII/CA12 Products

Product Documents for Carbonic Anhydrase XII/CA12 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Carbonic Anhydrase XII/CA12 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...