Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

Cadherin-13 Antibody

Catalog # NBP1-85708 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85708

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Cadherin-13 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLA

Predicted Species

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cadherin-13 Antibody

Western Blot: Cadherin-13 Antibody [NBP1-85708] - Analysis in human cell line U-138MG.
Immunocytochemistry/Immunofluorescence: Cadherin-13 Antibody [NBP1-85708] - Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane. Antibody staining is shown in green.

Applications for Cadherin-13 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04 - 0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cadherin-13

The H Cadherin gene is a member of the cadherin superfamily. The encoded protein is a calcium dependent cell-cell adhesionglycoprotein comprised of five extracellular cadherin repeats, a transmembrane region but, unlike the typical cadherinsuperfamily member, lacks

Alternate Names

Cadherin13, CDH13, H-Cadherin, T-Cadherin

Gene Symbol

CDH13

Additional Cadherin-13 Products

Product Documents for Cadherin-13 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cadherin-13 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...