Skip to main content

ATF3 Antibody

Catalog # NBP1-85816 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85816
NBP1-85816-25ul

Key Product Details

Validated by

Knockout/Knockdown, Biological Validation

Species Reactivity

Human, Mouse, Rat, Feline

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Frozen, Immunohistochemistry-Paraffin, Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ATF3 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30993183). Feline reactivity reported from a verified customer review. Rat reactivity reported in (PMID: 30101191), also customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATF3 Antibody

Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase and ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. ST88-14 cells were transfected for 24 h with either non-targeting (NT)-siRNA or Usp9X-siRNA. Whole cell extracts were collected prior to Western blot analysis for ATF3, Noxa and beta-actin. Numbers shows protein quantification analyzed through ImageJ. N = 3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-35806-5), licensed under a CC-BY license.
Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - ATF3 antibody in indirect immunofluorescence staining of human tumor cells using a green-fluorescent secondary antibody showing nuclear localization. Nuclei stained with DAPI (blue). Image from verified customer review.
Immunohistochemistry: ATF3 Antibody [NBP1-85816] - AAV8-mediated deletion of Tsc2 in adult mice induces a pro-regenerative environment in DRG. Immunohistochemistry of uninjured L4 DRG stained for ATF3 and Isl1. Image collected and cropped by CiteAb from the following publication (http://eneuro.org/lookup/doi/10.1523/ENEURO.0168-19.2019), licensed under a CC-BY license.

Applications for ATF3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Frozen

-Validated from a verified customer review.

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

-Reactivity reported in (PMID: 24939851)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 3 reviews rated 4.3 using NBP1-85816 in the following applications:

Published Applications

Read 28 publications using NBP1-85816 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATF3

Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.

Alternate Names

activating transcription factor 3cAMP-dependent transcription factor ATF-3, ATF3deltaZip2, ATF3deltaZip2c, ATF3deltaZip3, cyclic AMP-dependent transcription factor ATF-3

Gene Symbol

ATF3

Product Documents for ATF3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATF3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...