alpha Adaptin Antibody (8R8B6)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16402
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 8R8B6 expressed in HEK293
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human alpha Adaptin (O95782). MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISV
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
108 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit alpha Adaptin Antibody (8R8B6) (NBP3-16402) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for alpha Adaptin Antibody (8R8B6)
Western Blot: alpha Adaptin Antibody (8R8B6) [NBP3-16402]
Western Blot: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Western blot analysis of extracts of various cell lines, using alpha Adaptin Rabbit mAb (NBP3-16402) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402]
Immunocytochemistry/Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Immunofluorescence analysis of C6 cells using alpha Adaptin Rabbit mAb (NBP3-16402) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] -
Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Confocal imaging of NIH/3T3 cells using alpha Adaptin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Applications for alpha Adaptin Antibody (8R8B6)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: alpha Adaptin
Alternate Names
100 kDa coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, adaptor-related protein complex 2, alpha 1 subunit, ADTAAAP2-ALPHA, Alpha1-adaptin, Alpha-adaptin A, AP-2 complex subunit alpha-1, CLAPA1adaptin, alpha A, Clathrin assembly protein complex 2 alpha-A large chain, clathrin-associated/assembly/adaptor protein, large, alpha 1, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit
Gene Symbol
AP2A1
Additional alpha Adaptin Products
Product Documents for alpha Adaptin Antibody (8R8B6)
Product Specific Notices for alpha Adaptin Antibody (8R8B6)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...