Skip to main content

ACSL5 Antibody (5H8), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00051703-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00051703-M01

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 5H8

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACSL5 Antibody (5H8)

Immunogen

ACSL5 (NP_057318, 91 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS

Reactivity Notes

Human. Other species not tested.

Specificity

ACSL5 - acyl-CoA synthetase long-chain family member 5

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for ACSL5 Antibody (5H8)

Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - ACSL5 monoclonal antibody (M01), clone 5H8 Analysis of ACSL5 expression in HepG2.
Immunohistochemistry-Paraffin: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody (M01), clone 5H8.Lane 1: ACSL5 transfected lysate(82.3 KDa).Lane 2: Non-transfected lysate.

Applications for ACSL5 Antibody (5H8)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ACSL5

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Alternate Names

ACS2, ACS5FACL5 for fatty acid coenzyme A ligase 5, acyl-CoA synthetase long-chain family member 5, EC 6.2.1, EC 6.2.1.3, FACL5fatty acid coenzyme A ligase 5, fatty-acid-Coenzyme A ligase, long-chain 5, LACS 5, Long-chain acyl-CoA synthetase 5, long-chain fatty acid coenzyme A ligase 5, long-chain-fatty-acid--CoA ligase 5

Entrez Gene IDs

51703 (Human)

Gene Symbol

ACSL5

OMIM

605677 (Human)

Additional ACSL5 Products

Product Documents for ACSL5 Antibody (5H8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACSL5 Antibody (5H8)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...