Skip to main content

ACSBG1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-31990

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-31990-25ul
NBP2-31990

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACSBG1 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACSBG1 Antibody

Western Blot: ACSBG1 Antibody [NBP2-31990] - Analysis using Anti-ACSBG1 antibody NBP2-31990 (A) shows similar pattern to independent antibody NBP2-58214 (B).
Immunohistochemistry: ACSBG1 Antibody [NBP2-31990] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.

Applications for ACSBG1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACSBG1

ACSBG1 (Acyl CoA synthetase bubblegum family member 1) possesses long-chain acyl-CoA synthetase activity. It mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is thought to play a central role in brain very long-chain fatty acids metabolism and myelinogenesis.

Alternate Names

acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3, BG1, BGMBG, bubblegum, FLJ30320, hBG1, hsBG, hsBGM, KIAA0631GR-LACS, lipidosin, long-chain-fatty-acid--CoA ligase ACSBG1, LPD, MGC14352, very long-chain acyl-CoA synthetase

Gene Symbol

ACSBG1

UniProt

Additional ACSBG1 Products

Product Documents for ACSBG1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACSBG1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...