Skip to main content

ACP6 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89272

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89272
NBP1-89272-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACP6 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ACP6 Antibody

Western Blot: ACP6 Antibody [NBP1-89272] - Analysis in control (vector only transfected HEK293T lysate) and ACP6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ACP6 Antibody [NBP1-89272] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Applications for ACP6 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACP6

Hydrolyzes lysophosphatidic acid to monoacylglycerol

Long Name

Lysophosphatidic Acid Phosphatase 6

Alternate Names

ACPL1, LPAP, PACPL1

Entrez Gene IDs

51205 (Human)

Gene Symbol

ACP6

UniProt

Additional ACP6 Products

Product Documents for ACP6 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACP6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...