Skip to main content

ACOX3 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-85901

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85901-25ul
NBP1-85901

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACOX3 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25096407).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACOX3 Antibody

Western Blot: ACOX3 Antibody [NBP1-85901] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: ACOX3 Antibody [NBP1-85901] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.

Applications for ACOX3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04 - 0.4 ug/ml
Application Notes
ICC/IF reported in scientific literature (PMID: 25096407). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 2 publications using NBP1-85901 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOX3

ACOX3, also known as Peroxisomal acyl-coenzyme A oxidase 3, consists of a 78 kDa and a shorter 70 kDa isoform, and is involved in the oxidation of 2-methyl-branched fatty acids in CoA-esters. Disease research is currently being conducted with ACOX3 and its relation to prostate cancer, prostatitis, and leukemia. This protein has been shown to have interactions with SMURF2, SLC2A4, ACAA1, ACAA2, and ACAT1 in the PPAR signaling pathway and a variety of metabolic pathways including those of peroxisomal lipids, lipoproteins, and fatty acids.

Alternate Names

acyl-CoA oxidase 3, pristanoyl, Branched-chain acyl-CoA oxidase, BRCACox, BRCOX, EC 1.3.3.6, peroxisomal acyl-coenzyme A oxidase 3, PRCOX, pristanoyl, Pristanoyl-CoA oxidase

Gene Symbol

ACOX3

Additional ACOX3 Products

Product Documents for ACOX3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOX3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...