Skip to main content

ACOT8 Antibody - Azide and BSA Free, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-92103

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-92103-0.1ml
NBP2-92103-0.02ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for ACOT8 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ACOT8 (NP_005460.2). MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ACOT8 Antibody - Azide and BSA Free

Western Blot: ACOT8 Antibody [NBP2-92103] - Analysis of extracts of various cell lines, using ACOT8 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Applications for ACOT8 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ACOT8

ACOT8 is encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

ACTEIII, acyl-CoA thioesterase 8HNAACTE, Choloyl-coenzyme A thioesterase, EC 3.1.2.27, hACTEIII, HIV-Nef-associated acyl-CoA thioesterase, hTEcholoyl-CoA hydrolase, long-chain fatty-acyl-CoA hydrolase, palmitoyl-CoA hydrolase, peroxisomal acyl-CoA thioesterase, peroxisomal acyl-CoA thioesterase 1, Peroxisomal acyl-coenzyme A thioester hydrolase 1, Peroxisomal long-chain acyl-CoA thioesterase 1, PTE-1, PTE1HIV-Nef associated acyl-CoA thioesterase, PTE2, PTE-2hACTE-IIIacyl-coenzyme A thioesterase 8, Thioesterase II, thioesterase III

Gene Symbol

ACOT8

Additional ACOT8 Products

Product Documents for ACOT8 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOT8 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...