Skip to main content

ACOT8 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00010005-B01P

Catalog #
Availability
Size / Price
Qty
Loading...
H00010005-B01P

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACOT8 Antibody

Immunogen

ACOT8 (NP_005460.2, 1 a.a. - 319 a.a.) full-length human protein. MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL

Specificity

ACOT8 - acyl-CoA thioesterase 8,

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Scientific Data Images for ACOT8 Antibody

Western Blot: ACOT8 Antibody [H00010005-B01P] - Analysis of ACOT8 expression in transfected 293T cell line by ACOT8 polyclonal antibody. Lane 1: ACOT8 transfected lysate(35.09 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ACOT8 Antibody [H00010005-B01P] - Analysis of purified antibody to ACOT8 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: ACOT8 Antibody [H00010005-B01P] - Western Blot analysis of ACOT8 expression in human spleen.

Applications for ACOT8 Antibody

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ACOT8

The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

ACTEIII, acyl-CoA thioesterase 8HNAACTE, Choloyl-coenzyme A thioesterase, EC 3.1.2.27, hACTEIII, HIV-Nef-associated acyl-CoA thioesterase, hTEcholoyl-CoA hydrolase, long-chain fatty-acyl-CoA hydrolase, palmitoyl-CoA hydrolase, peroxisomal acyl-CoA thioesterase, peroxisomal acyl-CoA thioesterase 1, Peroxisomal acyl-coenzyme A thioester hydrolase 1, Peroxisomal long-chain acyl-CoA thioesterase 1, PTE-1, PTE1HIV-Nef associated acyl-CoA thioesterase, PTE2, PTE-2hACTE-IIIacyl-coenzyme A thioesterase 8, Thioesterase II, thioesterase III

Entrez Gene IDs

10005 (Human)

Gene Symbol

ACOT8

Additional ACOT8 Products

Product Documents for ACOT8 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOT8 Antibody

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...