Skip to main content

ACOT6 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-31708

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-31708-25ul
NBP2-31708

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACOT6 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACOT6 Antibody

Western Blot: ACOT6 Antibody [NBP2-31708] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: ACOT6 Antibody [NBP2-31708] - Staining of human cerebral cortex shows cytoplasmic and nucleolar positivity in neuronal cells.

Applications for ACOT6 Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT6

Alternate Names

acyl-CoA thioesterase 6c14_5530, C14orf42, chromosome 14 open reading frame 42, EC 3.1.2.-, EC 3.1.2.2, MGC161656, MGC161658, putative acyl-coenzyme A thioesterase 6

Gene Symbol

ACOT6

UniProt

Additional ACOT6 Products

Product Documents for ACOT6 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOT6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...