Skip to main content

ACOT2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-86947

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-86947

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for ACOT2 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ACOT2. Peptide sequence: NKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACOT2 Antibody

Western Blot: ACOT2 Antibody [NBP2-86947] - Host: Rabbit. Target Name: ACOT2. Sample Tissue: Stomach Tumor lysates. Antibody Dilution: 1ug/ml

Applications for ACOT2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT2

Alternate Names

acyl-CoA thioesterase 2MTE1, Acyl-coenzyme A thioester hydrolase 2a, acyl-coenzyme A thioesterase 2, mitochondrial, CTE-Ia, EC 3.1.2.2, Long-chain acyl-CoA thioesterase 2, mitochondrial acyl-CoA thioesterase 1, mitochondrial acyl-CoA thioesterase 2, peroxisomal long-chain acyl-coA thioesterase 2, PTE2A, PTE2CTE1A, ZAP128Mte1

Gene Symbol

ACOT2

Additional ACOT2 Products

Product Documents for ACOT2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...