Skip to main content

ACOT2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-70402

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-70402

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ACOT2 Antibody

Immunogen

Synthetic peptides corresponding to ACOT2(acyl-CoA thioesterase 2) The peptide sequence was selected form the middle region of ACOT2 (NP_006812). Peptide sequence SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACOT2 Antibody

Western Blot: ACOT2 Antibody [NBP1-70402] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: ACOT2 Antibody [NBP1-70402] - Human Fetal Liver.

Applications for ACOT2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT2

Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA (Hunt et al., 2005 [PubMed 16103133]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 CR610624.1 1-7 8-1155 BC006335.2 1-1148 1156-1767 L40401.1 468-1079

Alternate Names

acyl-CoA thioesterase 2MTE1, Acyl-coenzyme A thioester hydrolase 2a, acyl-coenzyme A thioesterase 2, mitochondrial, CTE-Ia, EC 3.1.2.2, Long-chain acyl-CoA thioesterase 2, mitochondrial acyl-CoA thioesterase 1, mitochondrial acyl-CoA thioesterase 2, peroxisomal long-chain acyl-coA thioesterase 2, PTE2A, PTE2CTE1A, ZAP128Mte1

Entrez Gene IDs

10965 (Human)

Gene Symbol

ACOT2

UniProt

Additional ACOT2 Products

Product Documents for ACOT2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...