Skip to main content

Aconitase 1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP3-10536

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-10536-100ul

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for Aconitase 1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Aconitase 1 (NP_002188). Peptide sequence MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aconitase 1 Antibody

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP3-10536] - Immunohistochemical analysis of paraffin-embedded human muscle tissue.

Applications for Aconitase 1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aconitase 1

Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Alternate Names

Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS

Gene Symbol

ACO1

Additional Aconitase 1 Products

Product Documents for Aconitase 1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Aconitase 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...