Skip to main content

ACK1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-90822

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90822-25ul
NBP1-90822

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACK1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACK1 Antibody

Immunohistochemistry-Paraffin: ACK1 Antibody [NBP1-90822] - Staining of human lateral ventricle shows strong nuclear and cytoplasmic positivity in neuronal cells.

Applications for ACK1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACK1

The ACK1 gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-termi

Long Name

Activated CDC42 kinase 1

Alternate Names

TNK2

Gene Symbol

TNK2

Additional ACK1 Products

Product Documents for ACK1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACK1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...