Skip to main content

Acetyl-CoA Carboxylase alpha/ACACA Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-55439

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55439-25ul
NBP2-55439

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Acetyl-CoA Carboxylase alpha/ACACA Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Acetyl-CoA Carboxylase alpha/ACACA Antibody

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-55439] - Analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-55439] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center, cytosol & actin filaments. Antibody staining is shown in green.

Applications for Acetyl-CoA Carboxylase alpha/ACACA Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP2-55439 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Acetyl-CoA Carboxylase alpha/ACACA

Acetyl-CoA carboxylase 1 (ACC1) is a biotin dependent lipogenic enzyme that is highly expressed during adipogenesis. ACC1 catalyzes acetyl-CoA carboxylation, producing malonyl-CoA, a metabolite involved in energy homeostasis regulation. Malonyl-CoA is a two carbon donor in the synthesis of long-chain fatty acids and the elongation of fatty acids found in the cystol (1). ACC1 is regulated short-term by citrate, CoA, and palmitoyl-CoA through allosteric interactions. Nutrients and hormones can be both short-term (inducing reversible phosphorylations by such as AMPK) and long-term (transcription level regulation) regulators of ACC1 (2). Highly expressed in lipogenic tissues, ACC1 is found in liver, adipose, and lactating mammary gland (3). ACC1 has been implicated as a target in the development of anti-obesity drugs (4).

Long Name

Acetyl-Coenzyme A Carboxylase alpha

Alternate Names

ACACA, ACC1, ACCA, AcetylCoA Carboxylase alpha

Gene Symbol

ACACA

Additional Acetyl-CoA Carboxylase alpha/ACACA Products

Product Documents for Acetyl-CoA Carboxylase alpha/ACACA Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Acetyl-CoA Carboxylase alpha/ACACA Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...