Skip to main content

ACCSL Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP3-17566

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17566-100ul
NBP3-17566-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACCSL Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACCSL Antibody

Immunocytochemistry/Immunofluorescence: ACCSL Antibody [NBP3-17566] - Staining of human cell line HEL shows localization to cytosol.

Applications for ACCSL Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACCSL

Alternate Names

1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like, ACC synthase-like protein 2,1-aminocyclopropane-1-carboxylate synthase-like protein 2

Gene Symbol

ACCSL

Additional ACCSL Products

Product Documents for ACCSL Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACCSL Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...