Skip to main content

ACCSL Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-70401

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-70401

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ACCSL Antibody

Immunogen

Synthetic peptides corresponding to LOC390110(hypothetical protein) The peptide sequence was selected from the N terminal of LOC390110 (NP_001027025). Peptide sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACCSL Antibody

Western Blot: ACCSL Antibody [NBP1-70401] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for ACCSL Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACCSL

The exact function of LOC390110 remains unknown.

Alternate Names

1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like, ACC synthase-like protein 2,1-aminocyclopropane-1-carboxylate synthase-like protein 2

Entrez Gene IDs

390110 (Human)

Gene Symbol

ACCSL

UniProt

Additional ACCSL Products

Product Documents for ACCSL Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACCSL Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...