Skip to main content

ACCN1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-84381

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-84381-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for ACCN1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACCN1. Peptide sequence: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACCN1 Antibody

Western Blot: ACCN1 Antibody [NBP2-84381] - WB Suggested Anti-ACCN1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: THP-1 cell lysate

Applications for ACCN1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACCN1

FUNCTION: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate.; SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins. Interacts with STOM. Interacts with PRKCABP and ACCN3.; SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. Note: Localized at the plasma membrane of neurons, in the soma and punctated peripheral processes.

Alternate Names

Acid-sensing ion channel 2, Amiloride-sensitive brain sodium channel, amiloride-sensitive cation channel 1, neuronal, ASIC2a, ASIC2Mammalian degenerin homolog, BNAC1, BNaC1ACCN, BNC1Amiloride-sensitive cation channel neuronal 1, degenerin, hBNaC1, MDEGBrain sodium channel 1, neuronal amiloride-sensitive cation channel 1

Gene Symbol

ASIC2

Additional ACCN1 Products

Product Documents for ACCN1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACCN1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...