Skip to main content

ACBD7 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-86945

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-86945

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for ACBD7 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ACBD7. Peptide sequence: KQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ACBD7 Antibody

Western Blot: ACBD7 Antibody [NBP2-86945] - Host: Rabbit. Target Name: ACBD7. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for ACBD7 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACBD7

Alternate Names

acyl-CoA binding domain containing 7, acyl-CoA-binding domain-containing protein 7, acyl-Coenzyme A binding domain containing 7, bA455B2.2, FLJ38219, FLJ52263, MGC33893

Gene Symbol

ACBD7

Additional ACBD7 Products

Product Documents for ACBD7 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACBD7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...