Skip to main content

ACBD3 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-83379

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-83379
NBP1-83379-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACBD3 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%). Reactivity reported in scientific literature (PMID: 23926333)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACBD3 Antibody

Western Blot: ACBD3 Antibody [NBP1-83379] - Analysis in control (vector only transfected HEK293T lysate) and ACBD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: ACBD3 Antibody [NBP1-83379] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ACBD3 Antibody [NBP1-83379] - Staining of human duodenum shows strong granular positivity in glandular cells.

Applications for ACBD3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 2 publications using NBP1-83379 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACBD3

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Alternate Names

acyl-CoA binding domain containing 3, Acyl-CoA-binding domain-containing protein 3, acyl-Coenzyme A binding domain containing 3, GCP60Golgi phosphoprotein 1, GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7, golgi complex associated protein 1, 60kDa, Golgi complex-associated protein 1, Golgi resident protein GCP60, GOLPH1PBR- and PKA-associated protein 7, PAP7, PBR associated protein, peripherial benzodiazepine receptor associated protein, PKA (RIalpha)-associated protein

Gene Symbol

ACBD3

Additional ACBD3 Products

Product Documents for ACBD3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACBD3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...