Skip to main content

ACBD3 Antibody (2H2), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00064746-M02

Catalog #
Availability
Size / Price
Qty
Loading...
H00064746-M02

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2H2

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACBD3 Antibody (2H2)

Immunogen

ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL

Specificity

ACBD3 - acyl-Coenzyme A binding domain containing 3 (2H2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for ACBD3 Antibody (2H2)

Western Blot: ACBD3 Antibody (2H2) [H00064746-M02] - ACBD3 monoclonal antibody (M02), clone 2H2. Analysis of ACBD3 expression in A-431.
Immunocytochemistry/Immunofluorescence: ACBD3 Antibody (2H2) [H00064746-M02] - Analysis of monoclonal antibody to ACBD3 on HeLa cell . Antibody concentration 10 ug/ml.
Western Blot: ACBD3 Antibody (2H2) [H00064746-M02] - ACBD3 monoclonal antibody (M02), clone 2H2. Analysis of ACBD3 expression in PC-12.

Applications for ACBD3 Antibody (2H2)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ACBD3

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq]

Alternate Names

acyl-CoA binding domain containing 3, Acyl-CoA-binding domain-containing protein 3, acyl-Coenzyme A binding domain containing 3, GCP60Golgi phosphoprotein 1, GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7, golgi complex associated protein 1, 60kDa, Golgi complex-associated protein 1, Golgi resident protein GCP60, GOLPH1PBR- and PKA-associated protein 7, PAP7, PBR associated protein, peripherial benzodiazepine receptor associated protein, PKA (RIalpha)-associated protein

Entrez Gene IDs

64746 (Human)

Gene Symbol

ACBD3

Additional ACBD3 Products

Product Documents for ACBD3 Antibody (2H2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACBD3 Antibody (2H2)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...