Skip to main content

ACAP4 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-48550

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48550
NBP2-48550-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACAP4 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA

Reactivity Notes

Rat (82%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACAP4 Antibody

Immunohistochemistry-Paraffin: ACAP4 Antibody [NBP2-48550] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non-germinal center cells.

Applications for ACAP4 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAP4

ACAP4 encodes a member of a subfamily of ADP-ribosylation factor(Arf) GTPase-activating proteins that contain additional ankyrin repeat and pleckstrin homology domains. The Arf GAP domain of this protein catalyzes the hydrolysis of GTP bound to Arf proteins. The encoded protein promotes cell differentiation and migration and has been implicated in cancer cell invasion. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Alternate Names

ARF6 GTPase-activating protein, arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 1, centaurin, beta 6, CENTB6, DDEFL1, development and differentiation enhancing factor-like 1, Development and differentiation-enhancing factor-like 1, FLJ20199, Protein up-regulated in liver cancer 1, UPLC1ACAP4, up-regulated in liver cancer 1 (UPLC1)

Gene Symbol

ASAP3

Additional ACAP4 Products

Product Documents for ACAP4 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAP4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...