Skip to main content

ACADS Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89290

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89290-25ul
NBP1-89290

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACADS Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACADS Antibody

Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Analysis in human duodenum and tonsil tissues. Corresponding ACADS RNA-seq data are presented for the same tissues.
Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: ACADS Antibody [NBP1-89290] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.

Applications for ACADS Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACADS

ACADS encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. [provided by RefSeq]

Alternate Names

ACAD3, acyl-CoA dehydrogenase, C-2 to C-3 short chain, acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain, Butyryl-CoA dehydrogenase, EC 1.3.99, EC 1.3.99.2, mitochondrial short-chain specific acyl-CoA dehydrogenase, SCADshort-chain acyl-CoA dehydrogenase, short-chain specific acyl-CoA dehydrogenase, mitochondrial, unsaturated acyl-CoA reductase

Gene Symbol

ACADS

Additional ACADS Products

Product Documents for ACADS Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACADS Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...