Skip to main content

ACAD9 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-56718

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56718-25ul
NBP2-56718

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACAD9 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLA

Reactivity Notes

Mouse 87%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACAD9 Antibody

Western Blot: ACAD9 Antibody [NBP2-56718] - Analysis using Anti-ACAD9 antibody NBP2-56718 (A) shows similar pattern to independent antibody NBP1-82749 (B).
Immunocytochemistry/Immunofluorescence: ACAD9 Antibody [NBP2-56718] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Applications for ACAD9 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAD9

Mitochondrial fatty acid beta-oxidation is one of the main energy-producing metabolic pathways in eukaryotes. Acyl-CoA dehydrogenases (ACADs; EC 1.3.99.13) are mitochondrial enzymes that catalyze the initial rate-limiting step in the beta-oxidation of fatty acyl-CoA. ACAD9 belongs to a group of ACADs that act on fatty acids containing 14 to 20 carbons (Zhang et al., 2002 [PubMed 12359260]).[supplied by OMIM]

Alternate Names

ACAD-9, acyl-CoA dehydrogenase family member 9, mitochondrial, acyl-CoA dehydrogenase family, member 9, acyl-Coenzyme A dehydrogenase family, member 9, EC 1.3.99, EC 1.3.99.-, EC 1.3.99.10, FLJ23533, MGC14452, NPD002

Gene Symbol

ACAD9

Additional ACAD9 Products

Product Documents for ACAD9 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAD9 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...