Skip to main content

ACAD9 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-74272

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-74272

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ACAD9 Antibody

Immunogen

Synthetic peptides corresponding to the C terminal of ACAD9. Immunizing peptide sequence RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACAD9 Antibody

Western Blot: ACAD9 Antibody [NBP1-74272] - 721_B Cell Lysate 1ug/ml Gel Concentration 12%

Applications for ACAD9 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAD9

This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency.

Alternate Names

ACAD-9, acyl-CoA dehydrogenase family member 9, mitochondrial, acyl-CoA dehydrogenase family, member 9, acyl-Coenzyme A dehydrogenase family, member 9, EC 1.3.99, EC 1.3.99.-, EC 1.3.99.10, FLJ23533, MGC14452, NPD002

Gene Symbol

ACAD9

UniProt

Additional ACAD9 Products

Product Documents for ACAD9 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAD9 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...