Skip to main content

ACAD8 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00027034-B01P

Catalog #
Availability
Size / Price
Qty
Loading...
H00027034-B01P

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACAD8 Antibody

Immunogen

ACAD8 (AAH01964.1, 1 a.a. - 415 a.a.) full-length human protein. MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Scientific Data Images for ACAD8 Antibody

Western Blot: ACAD8 Antibody [H00027034-B01P] - Analysis of ACAD8 expression in transfected 293T cell line by ACAD8 polyclonal antibody. Lane 1: ACAD8 transfected lysate(45.65 KDa). Lane 2: Non-transfected lysate.

Applications for ACAD8 Antibody

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for Western Blot, Functional
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS (pH 7.4)

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ACAD8

Isobutyryl-CoA dehydrogenase (EC 1.3.99), encoded by the ACAD8 gene, catalyzes the third step of the degradation of the branched chain amino acid valine (Nguyen et al., 2002 [PubMed 12359132]).[supplied by OMIM]

Alternate Names

ACAD-8, Activator-recruited cofactor 42 kDa component, Acyl-CoA dehydrogenase family member 8, acyl-CoA dehydrogenase family, member 8, acyl-Coenzyme A dehydrogenase family, member 8, ARC42, EC 1.3.99, EC 1.3.99.-, FLJ22590, IBD, isobutyryl-CoA dehydrogenase, mitochondrial

Gene Symbol

ACAD8

Additional ACAD8 Products

Product Documents for ACAD8 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAD8 Antibody

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...