Skip to main content

ACAA1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-85786

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85786
NBP1-85786-25ul

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACAA1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24762439).

Marker

Peroxisome Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ACAA1 Antibody

Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-85786] - Analysis in human liver and pancreas tissues using NBP1-85786 antibody. Corresponding ACAA1 RNA-seq data are presented for the same tissues.
Western Blot: ACAA1 Antibody [NBP1-85786] - Analysis using Anti-ACAA1 antibody NBP1-85786 (A) shows similar pattern to independent antibody NBP1-86128 (B).
Immunocytochemistry/Immunofluorescence: ACAA1 Antibody [NBP1-85786] - Staining of human cell line U-251MG shows positivity in vesicles. Antibody staining shown in green.

Applications for ACAA1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 24762439). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP1-85786 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAA1

Acetyl-Coenzyme A acyltransferase (ACAA1) is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome

Alternate Names

Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal

Entrez Gene IDs

30 (Human)

Gene Symbol

ACAA1

UniProt

Additional ACAA1 Products

Product Documents for ACAA1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAA1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...