Skip to main content

ACAA1 Antibody (CL2662), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-42381

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-42381
NBP2-42381-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2B Clone # CL2662

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACAA1 Antibody (CL2662)

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ

Epitope

SMSLADRGNP

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (88%), Rat (87%).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2B

Scientific Data Images for ACAA1 Antibody (CL2662)

Western Blot: ACAA1 Antibody (CL2662) [NBP2-42381] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line U-251
Immunocytochemistry/Immunofluorescence: ACAA1 Antibody (CL2662) [NBP2-42381] - Staining of CACO-2 cells using the Anti-ACAA1 monoclonal antibody, showing specific staining in peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry: ACAA1 Antibody (CL2662) [NBP2-42381] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.

Applications for ACAA1 Antibody (CL2662)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

2-10 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAA1

Acetyl-Coenzyme A acyltransferase (ACAA1) is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome

Alternate Names

Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal

Gene Symbol

ACAA1

UniProt

Additional ACAA1 Products

Product Documents for ACAA1 Antibody (CL2662)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAA1 Antibody (CL2662)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...