Skip to main content

ACAA1 Antibody (3F11), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000030-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00000030-M01

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3F11

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ACAA1 Antibody (3F11)

Immunogen

ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD

Specificity

ACAA1 - acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase) (3F11)

Marker

Peroxisome Marker

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for ACAA1 Antibody (3F11)

Western Blot: ACAA1 Antibody (3F11) [H00000030-M01] - ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in A-431.
Immunocytochemistry/Immunofluorescence: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of monoclonal antibody to ACAA1 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ACAA1 Antibody (3F11) [H00000030-M01] - Analysis of monoclonal antibody to ACAA1 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.

Applications for ACAA1 Antibody (3F11)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ACAA1

This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Alternate Names

Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal

Entrez Gene IDs

30 (Human)

Gene Symbol

ACAA1

Additional ACAA1 Products

Product Documents for ACAA1 Antibody (3F11)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACAA1 Antibody (3F11)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...