Skip to main content

ABRA Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-79505

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-79505

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ABRA Antibody

Immunogen

Synthetic peptide directed towards the middle region of human ABRAThe immunogen for this antibody is ABRA. Peptide sequence QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ABRA Antibody

Western Blot: ABRA Antibody [NBP1-79505] - Human Lung lysate, concentration 0.2-1 ug/ml.

Applications for ABRA Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABRA

ABRA acts as an activator of serum response factor (SRF)-dependent transcription possibly by inducing nucleartranslocation of MKL1 or MKL2 and through a mechanism requiring Rho-actin signaling

Alternate Names

actin-binding Rho activating protein, actin-binding Rho-activating protein, STARSStriated muscle activator of Rho-dependent signaling

Gene Symbol

ABRA

Additional ABRA Products

Product Documents for ABRA Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABRA Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...