Skip to main content

ABLIM3 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-81471

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-81471
NBP1-81471-25ul

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABLIM3 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ABLIM3 Antibody

Western Blot: ABLIM3 Antibody [NBP1-81471] - Analysis in human cell line PC-3.
Immunocytochemistry/Immunofluorescence: ABLIM3 Antibody [NBP1-81471] - Staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: ABLIM3 Antibody [NBP1-81471] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Applications for ABLIM3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 3 publications using NBP1-81471 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABLIM3

The LIM domain is a double zinc finger structure that promotes protein-protein interactions. LIM domain proteins, such as ABLIM3, play roles in embryonic development, cell lineage determination, and cancer (Krupp et al., 2006 [PubMed 16328021]).[supplied by OMIM]

Alternate Names

actin binding LIM protein family, member 3, actin-binding LIM protein 3

Entrez Gene IDs

22885 (Human)

Gene Symbol

ABLIM3

UniProt

Additional ABLIM3 Products

Product Documents for ABLIM3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABLIM3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...