Skip to main content

ABLIM2 Antibody - Azide and BSA Free, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-92382

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-92382-0.1ml
NBP2-92382-0.02ml

Key Product Details

Species Reactivity

Validated:

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for ABLIM2 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 74-309 of human ABLIM2 (NP_115808.3). DYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSVGSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASSTSGSPSRVIYAKLGGEILD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABLIM2 Antibody - Azide and BSA Free

Western Blot: ABLIM2 Antibody [NBP2-92382] - Analysis of extracts of Rat lung, using ABLIM2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

Applications for ABLIM2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ABLIM2

ABLIM2 may act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity

Alternate Names

actin binding LIM protein family, member 2, FLJ26534

Gene Symbol

ABLIM2

Additional ABLIM2 Products

Product Documents for ABLIM2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABLIM2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...