Skip to main content

ABL2 Antibody (6D5), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000027-M03

Catalog #
Availability
Size / Price
Qty
Loading...
H00000027-M03

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Applications

ELISA, Immunoprecipitation, Knockdown Validated, Proximity Ligation Assay, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 6D5

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABL2 Antibody (6D5)

Immunogen

ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA

Specificity

ABL2 (6D5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for ABL2 Antibody (6D5)

Western Blot: ABL2 Antibody (6D5) [H00000027-M03] - Analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody (M03), clone 6D5. Lane 1: ABL2 transfected lysatE (126.7 KDa). Lane 2: Non-transfected lysate.
Western Blot: ABL2 Antibody (6D5) [H00000027-M03] - Analysis of ABL2 over-expressed 293 cell line. Lane 2 cotransfected with ABL2 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000027-M03. GAPDH ( 36.1 kDa ) used as loading control.
Western Blot: ABL2 Antibody (6D5) [H00000027-M03] - Analysis of ABL2 expression in Hela S3 NE (Cat # L013V3).

Applications for ABL2 Antibody (6D5)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ABL2

The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed in both normal and tumor cells. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Long Name

Tyrosine-protein kinase ABL2

Alternate Names

ABLL, ARG, EC 2.7.10.2

Entrez Gene IDs

27 (Human)

Gene Symbol

ABL2

OMIM

164690 (Human)

Additional ABL2 Products

Product Documents for ABL2 Antibody (6D5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABL2 Antibody (6D5)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...