Skip to main content

ABHD11 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-33574

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33574
NBP2-33574-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABHD11 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABHD11 Antibody

Western Blot: ABHD11 Antibody [NBP2-33574] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: ABHD11 Antibody [NBP2-33574] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ABHD11 Antibody [NBP2-33574] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Applications for ABHD11 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP2-33574 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABHD11

ABHD11 encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Alternate Names

abhydrolase domain containing 11, abhydrolase domain-containing protein 11, EC 3.-, PP1226, WBSCR21, Williams Beuren syndrome chromosome region 21, Williams-Beuren syndrome chromosomal region 21 protein

Gene Symbol

ABHD11

UniProt

Additional ABHD11 Products

Product Documents for ABHD11 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABHD11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...