Skip to main content

Key Product Details

Species Reactivity


Human, Mouse, Rat


Immunocytochemistry/ Immunofluorescence, Immunohistochemistry


DyLight 350 (Excitation = 353 nm, Emission = 432 nm)

Antibody Source

Monoclonal Mouse IgG2A Clone # S319A-14


Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCC9 Antibody (S319A-14) [DyLight 350]


Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A




Detects approx 120kDa. Does not cross-react with SUR2B.







Applications for ABCC9 Antibody (S319A-14) [DyLight 350]

Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.


Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage


Protein G purified


50mM Sodium Borate


0.05% Sodium Azide


Please see the vial label for concentration. If unlisted please contact technical services.


The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: ABCC9

The protein encoded by the ABCC9 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. (provided by RefSeq)

Long Name

ATP-binding cassette sub-family C member 9

Alternate Names


Gene Symbol


Additional ABCC9 Products

Product Documents for ABCC9 Antibody (S319A-14) [DyLight 350]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCC9 Antibody (S319A-14) [DyLight 350]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
