Skip to main content

ABCC12 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-69063

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-69063

Key Product Details

Species Reactivity

Validated:

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ABCC12 Antibody

Immunogen

Synthetic peptides corresponding to Abcc12 (ATP-binding cassette, sub-family C (CFTR/MRP), member 12) The peptide sequence was selected from the middle region of Abcc12. Peptide sequence NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

153 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ABCC12 Antibody

Western Blot: ABCC12 Antibody [NBP1-69063] - Mouse Spleen lysate, concentration 0.2-1 ug/ml.

Applications for ABCC12 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCC12

Abcc12 is a probable transporter.

Alternate Names

ATP-binding cassette transporter sub-family C member 12, ATP-binding cassette, sub-family C (CFTR/MRP), member 12, MGC27071, MRP9ATP-binding cassette sub-family C member 12, multidrug resistance-associated protein 9

Gene Symbol

ABCC12

UniProt

Additional ABCC12 Products

Product Documents for ABCC12 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCC12 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...