Skip to main content

ABCB9 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-84783

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84783
NBP1-84783-25ul

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCB9 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCB9 Antibody

Immunohistochemistry-Paraffin: ABCB9 Antibody [NBP1-84783] - Staining of human testis shows strong cytoplasmic positivity.

Applications for ABCB9 Antibody

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCB9

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, this protein may play a role in lysosomes. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specifications. [provided by RefSeq]

Alternate Names

ABC transporter 9 protein, ATP-binding cassette sub-family B member 9, ATP-binding cassette transporter 9, ATP-binding cassette, sub-family B (MDR/TAP), member 9, EC 3.6.3, EC 3.6.3.44, EST122234, hABCB9, KIAA1520, TAPL, TAP-like protein

Gene Symbol

ABCB9

Additional ABCB9 Products

Product Documents for ABCB9 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCB9 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...