Skip to main content

ABCB9 Antibody (4F4), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00023457-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00023457-M01

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 4F4

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCB9 Antibody (4F4)

Immunogen

ABCB9 (NP_062571, 482 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR

Specificity

ABCB9 - ATP-binding cassette, sub-family B (MDR/TAP), member 9 (4F4)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for ABCB9 Antibody (4F4)

Immunocytochemistry/Immunofluorescence: ABCB9 Antibody (4F4) [H00023457-M01] - Analysis of monoclonal antibody to ABCB9 on HeLa cell . Antibody concentration 10 ug/ml.

Applications for ABCB9 Antibody (4F4)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ABCB9

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, this protein may play a role in lysosomes. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specifications. [provided by RefSeq]

Alternate Names

ABC transporter 9 protein, ATP-binding cassette sub-family B member 9, ATP-binding cassette transporter 9, ATP-binding cassette, sub-family B (MDR/TAP), member 9, EC 3.6.3, EC 3.6.3.44, EST122234, hABCB9, KIAA1520, TAPL, TAP-like protein

Entrez Gene IDs

23457 (Human)

Gene Symbol

ABCB9

Additional ABCB9 Products

Product Documents for ABCB9 Antibody (4F4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCB9 Antibody (4F4)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...