Skip to main content

ABCB8 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-86935

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-86935

Key Product Details

Species Reactivity

Validated:

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for ABCB8 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse ABCB8. Peptide sequence: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ABCB8 Antibody

Western Blot: ABCB8 Antibody [NBP2-86935] - WB Suggested Anti-Abcb8 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Muscle

Applications for ABCB8 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCB8

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, it may involve the compartmentalization and transport of heme, as well as peptides, from the mitochondria to the nucleus and cytosol. This protein may also play a role in the transport of phospholipids into mitochondrial membranes.

Alternate Names

ATP-binding cassette, sub-family B (MDR/TAP), member 8, EC 3.6.3, EST328128, M-ABC1mitochondrial ABC protein, mitochondrial, Mitochondrial ATP-binding cassette 1

Gene Symbol

ABCB8

Additional ABCB8 Products

Product Documents for ABCB8 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCB8 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...